
원본
Atlas Antibodies Anti-TPPP3 Antibody
상품 한눈에 보기
Human TPPP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. RNA-seq 기반 직교 검증을 통해 단백질 발현 확인이 가능합니다. 고순도 친화 정제 방식으로 제조되었으며, 다양한 조직 연구에 활용 가능합니다.
- 카탈로그번호
- HPA047629-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047629-100 Anti-TPPP3 Antibody, tubulin polymerization-promoting protein family member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047629-25 Anti-TPPP3 Antibody, tubulin polymerization-promoting protein family member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPPP3 Antibody
Anti-TPPP3 Antibody
Target: tubulin polymerization-promoting protein family member 3 (TPPP3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TPPP3.
Alternative Gene Names
CGI-38, p20, p25gamma
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tubulin polymerization-promoting protein family member 3 |
| Target Gene | TPPP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000014846 (95%), Rat ENSRNOG00000016890 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



