Atlas Antibodies Anti-TPR Antibody

상품 한눈에 보기

Human TPR 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인체 단백질 발현 검증에 유용.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019663-100 Anti-TPR Antibody, translocated promoter region, nuclear basket protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019663-25 Anti-TPR Antibody, translocated promoter region, nuclear basket protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TPR Antibody

Anti-TPR Antibody

Target: translocated promoter region, nuclear basket protein (TPR)
Supplier: Atlas Antibodies
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

Recommended Applications

IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TPR protein.

Open Datasheet

Target Information

항목	내용
Target Protein	translocated promoter region, nuclear basket protein
Target Gene	TPR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000002394 (90%), Mouse ENSMUSG00000006005 (88%)

Additional Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand