CacheBy
Atlas Antibodies Anti-TPR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPR Antibody

상품 한눈에 보기

Human TPR 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인체 단백질 발현 검증에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019663-100 Anti-TPR Antibody, translocated promoter region, nuclear basket protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019663-25 Anti-TPR Antibody, translocated promoter region, nuclear basket protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPR Antibody

Anti-TPR Antibody

Target: translocated promoter region, nuclear basket protein (TPR)
Supplier: Atlas Antibodies
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TPR protein.

Open Datasheet


Target Information

항목 내용
Target Protein translocated promoter region, nuclear basket protein
Target Gene TPR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000002394 (90%), Mouse ENSMUSG00000006005 (88%)

Additional Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.