CacheBy
Atlas Antibodies Anti-TPP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPP1 Antibody

상품 한눈에 보기

인간 TPP1 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 분석에 적합하며 RNA-seq 데이터 기반의 오쏘고날 검증을 거쳤습니다. 토끼 유래 IgG 형식으로 고순도 친화 정제되어 있습니다. 인간 반응성이 검증되었으며 CLN2, SCAR7 유전자 대체명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044868-100 Anti-TPP1 Antibody, tripeptidyl peptidase I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044868-25 Anti-TPP1 Antibody, tripeptidyl peptidase I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPP1 Antibody

Anti-TPP1 Antibody

Target Protein: Tripeptidyl peptidase I
Supplier: Atlas Antibodies

  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human TPP1.

Alternative Gene Names

  • CLN2
  • SCAR7

Open Datasheet

Target Information

항목 내용
Target Protein Tripeptidyl peptidase I
Target Gene TPP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (89%), Mouse (89%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

GCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPSYQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYW

Safety Information

Material Safety Data Sheet (MSDS)

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.