
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TPPP Antibody
상품 한눈에 보기
Human TPPP 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. Rabbit host에서 생산되었으며, PrEST 항원으로 affinity purification되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036576-100 Anti-TPPP Antibody, tubulin polymerization promoting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036576-25 Anti-TPPP Antibody, tubulin polymerization promoting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TPPP Antibody
Anti-TPPP Antibody
Target: Tubulin polymerization promoting protein (TPPP)
Type: Polyclonal Antibody against Human TPPP
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
Orthogonal validation:
Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human TPPP.
Alternative Gene Names
- p25
- p25alpha
- TPPP/p25
- TPPP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tubulin polymerization promoting protein |
| Target Gene | TPPP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLC |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (92%), Mouse (90%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



