CacheBy
Atlas Antibodies Anti-TPP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPP2 Antibody

상품 한눈에 보기

인간 TPP2 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간, 생쥐, 랫드에서 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021069-100 Anti-TPP2 Antibody, tripeptidyl peptidase II 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021069-25 Anti-TPP2 Antibody, tripeptidyl peptidase II 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPP2 Antibody

Anti-TPP2 Antibody

Target Information

  • Target Protein: Tripeptidyl peptidase II
  • Target Gene: TPP2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLST

Product Description

Polyclonal antibody against human TPP2.

Open Datasheet

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000011194 97%
Mouse ENSMUSG00000041763 96%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.