CacheBy
Atlas Antibodies Anti-TONSL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TONSL Antibody

상품 한눈에 보기

인간 TONSL 단백질을 표적으로 하는 폴리클로날 항체로, DNA 복구 관련 연구에 적합합니다. Rabbit 유래 IgG 항체이며, Affinity purified 방식으로 정제되었습니다. IHC 및 ICC 응용에 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046494-100 Anti-TONSL Antibody, tonsoku-like, DNA repair protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046494-25 Anti-TONSL Antibody, tonsoku-like, DNA repair protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TONSL Antibody

Anti-TONSL Antibody

tonsoku-like, DNA repair protein

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TONSL.

Alternative Gene Names

  • IKBR
  • NFKBIL2

Open Datasheet

Target Information

항목 내용
Target Protein tonsoku-like, DNA repair protein
Target Gene TONSL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000059323 (97%), Rat ENSRNOG00000014703 (97%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence (Epitope)

WNRRNDMGETLLHRACIEGQLRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITPLHDALNCGHFEVAELLLERGASVTLRTRK

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended Application
ICC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.