
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TOMM34 Antibody
상품 한눈에 보기
Human TOMM34 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 정제된 PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반 직교 검증을 통해 단백질 발현이 확인되었습니다. Human에 반응하며 Mouse, Rat과 높은 상동성을 보입니다.
- 카탈로그번호
- HPA018845-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018845-100 Anti-TOMM34 Antibody, translocase of outer mitochondrial membrane 34 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018845-25 Anti-TOMM34 Antibody, translocase of outer mitochondrial membrane 34 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TOMM34 Antibody
Anti-TOMM34 Antibody
Target: translocase of outer mitochondrial membrane 34 (TOMM34)
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TOMM34.
Alternative Gene Names
HTOM34P, TOM34
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of outer mitochondrial membrane 34 |
| Target Gene | TOMM34 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000018322 | 89% |
| Rat | ENSRNOG00000029799 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



