
Atlas Antibodies Anti-TOLLIP Antibody
상품 한눈에 보기
Human TOLLIP 단백질을 표적으로 하는 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합. 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. Rabbit 유래 IgG로, 프레스티 항원 기반 친화 정제 방식 사용.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TOLLIP Antibody
Target: toll interacting protein
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human TOLLIP
Alternative Gene Names
IL-1RAcPIP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | toll interacting protein |
| Target Gene | TOLLIP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA |
Verified Species Reactivity
Human, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000025139 | 88% |
| Rat | ENSRNOG00000019861 | 88% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TOMM20L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOM1L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOLLIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOGARAM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOGARAM2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.