CacheBy
Atlas Antibodies Anti-TNRC6C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TNRC6C Antibody

상품 한눈에 보기

휴먼 TNRC6C 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 특이적이며, Mouse 및 Rat과 88% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022007-100 Anti-TNRC6C Antibody, trinucleotide repeat containing 6C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022007-25 Anti-TNRC6C Antibody, trinucleotide repeat containing 6C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNRC6C Antibody

Anti-TNRC6C Antibody

Target: trinucleotide repeat containing 6C
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against human TNRC6C.


Alternative Gene Names

  • FLJ20015
  • KIAA1582

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein trinucleotide repeat containing 6C
Target Gene TNRC6C
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025571 (88%), Rat ENSRNOG00000022395 (88%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
ATQASNSGGKNDGSIMNSTNTSSVSGWVNAPPAAVPANTGWGDSNNKAPSGPGVWGDSISSTAVSTAAAAKSGHAWSGAANQEDKSPTWGEPPKPKSQHWGDGQRSNPAWSAGGGDWADSSS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.