
Atlas Antibodies Anti-TNRC6C Antibody
휴먼 TNRC6C 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 특이적이며, Mouse 및 Rat과 88% 서열 유사성을 가집니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TNRC6C Antibody
Target: trinucleotide repeat containing 6C
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against human TNRC6C.
Alternative Gene Names
- FLJ20015
- KIAA1582
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | trinucleotide repeat containing 6C |
| Target Gene | TNRC6C |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000025571 (88%), Rat ENSRNOG00000022395 (88%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
ATQASNSGGKNDGSIMNSTNTSSVSGWVNAPPAAVPANTGWGDSNNKAPSGPGVWGDSISSTAVSTAAAAKSGHAWSGAANQEDKSPTWGEPPKPKSQHWGDGQRSNPAWSAGGGDWADSSS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TNRC6B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNRC6A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNRC6C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNRC18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNRC18 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|