AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TNRC6C Antibody
상품 한눈에 보기
휴먼 TNRC6C 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 특이적이며, Mouse 및 Rat과 88% 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022007-100 Anti-TNRC6C Antibody, trinucleotide repeat containing 6C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022007-25 Anti-TNRC6C Antibody, trinucleotide repeat containing 6C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNRC6C Antibody
Anti-TNRC6C Antibody
Target: trinucleotide repeat containing 6C
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against human TNRC6C.
Alternative Gene Names
- FLJ20015
- KIAA1582
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | trinucleotide repeat containing 6C |
| Target Gene | TNRC6C |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000025571 (88%), Rat ENSRNOG00000022395 (88%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
ATQASNSGGKNDGSIMNSTNTSSVSGWVNAPPAAVPANTGWGDSNNKAPSGPGVWGDSISSTAVSTAAAAKSGHAWSGAANQEDKSPTWGEPPKPKSQHWGDGQRSNPAWSAGGGDWADSSS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.