CacheBy
Atlas Antibodies Anti-TNFSF15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TNFSF15 Antibody

상품 한눈에 보기

Human TNFSF15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. TL1A/VEGI 등 대체 유전자명으로도 알려져 있으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human에 대해 검증된 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046522-100 Anti-TNFSF15 Antibody, tumor necrosis factor (ligand) superfamily, member 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046522-25 Anti-TNFSF15 Antibody, tumor necrosis factor (ligand) superfamily, member 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNFSF15 Antibody

Anti-TNFSF15 Antibody

Target: tumor necrosis factor (ligand) superfamily, member 15
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합


Product Description

Polyclonal Antibody against Human TNFSF15


Alternative Gene Names

MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A

Open Datasheet


Target Information

항목 내용
Target Protein tumor necrosis factor (ligand) superfamily, member 15
Target Gene TNFSF15
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence FRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Species Reactivity

항목 내용
Verified Species Human
Ortholog Identity Rat ENSRNOG00000008930 (82%), Mouse ENSMUSG00000050395 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.