
Atlas Antibodies Anti-TNFSF15 Antibody
상품 한눈에 보기
Human TNFSF15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. TL1A/VEGI 등 대체 유전자명으로도 알려져 있으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human에 대해 검증된 반응성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TNFSF15 Antibody
Target: tumor necrosis factor (ligand) superfamily, member 15
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human TNFSF15
Alternative Gene Names
MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tumor necrosis factor (ligand) superfamily, member 15 |
| Target Gene | TNFSF15 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | FRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Ortholog Identity | Rat ENSRNOG00000008930 (82%), Mouse ENSMUSG00000050395 (77%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TNFSF14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFSF11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFSF15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFSF13B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNFSF15 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.