
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TNFRSF1A Antibody
상품 한눈에 보기
인간 TNFRSF1A를 인식하는 폴리클론 항체로, IHC 및 WB에 적합. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Rabbit IgG 형태로 Human 반응성 검증 완료. 연구용으로 사용 시 최적 조건은 사용자 설정 필요.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004102-100 Anti-TNFRSF1A Antibody, tumor necrosis factor receptor superfamily, member 1A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004102-25 Anti-TNFRSF1A Antibody, tumor necrosis factor receptor superfamily, member 1A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNFRSF1A Antibody
Anti-TNFRSF1A Antibody
Target: Tumor necrosis factor receptor superfamily, member 1A
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human TNFRSF1A.
Alternative Gene Names
CD120a, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR60
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor receptor superfamily, member 1A |
| Target Gene | TNFRSF1A |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (72%), Rat (70%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



