CacheBy
Atlas Antibodies Anti-TNFRSF13C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TNFRSF13C Antibody

상품 한눈에 보기

Human TNFRSF13C 단백질을 인식하는 고품질 Rabbit Polyclonal 항체로, IHC 및 WB 실험에 적합. Orthogonal 및 Recombinant Expression Validation 완료. BAFFR/CD268 타겟 검증 및 높은 특이성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003246-100 Anti-TNFRSF13C Antibody, tumor necrosis factor receptor superfamily, member 13C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003246-25 Anti-TNFRSF13C Antibody, tumor necrosis factor receptor superfamily, member 13C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNFRSF13C Antibody

Anti-TNFRSF13C Antibody

Tumor necrosis factor receptor superfamily, member 13C


  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human TNFRSF13C

Alternative Gene Names

BAFFR, CD268

Open Datasheet


Target Information

항목 내용
Target Protein Tumor necrosis factor receptor superfamily, member 13C
Target Gene TNFRSF13C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000068105 (57%), Rat ENSRNOG00000007664 (49%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.