
원본
Atlas Antibodies Anti-TNFRSF10B Antibody
상품 한눈에 보기
인간 TNFRSF10B를 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, Rabbit IgG 아이소타입입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. Human에 검증된 반응성을 갖습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023625-100 Anti-TNFRSF10B Antibody, tumor necrosis factor receptor superfamily, member 10b 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023625-25 Anti-TNFRSF10B Antibody, tumor necrosis factor receptor superfamily, member 10b 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNFRSF10B Antibody
Anti-TNFRSF10B Antibody
Target: Tumor necrosis factor receptor superfamily, member 10b
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human TNFRSF10B
Alternative Gene Names
CD262, DR5, KILLER, TRAIL-R2, TRICK2A, TRICKB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor receptor superfamily, member 10b |
| Target Gene | TNFRSF10B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022074 (30%) Rat ENSRNOG00000038483 (28%) |
Antigen Sequence:
GAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



