
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GCNT2 Antibody
상품 한눈에 보기
인간 GCNT2 단백질을 표적으로 하는 토끼 폴리클로날 항체. I 혈액형 관련 효소 검출에 적합하며, IHC 및 ICC에 사용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA026776-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026776-100 Anti-GCNT2 Antibody, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026776-25 Anti-GCNT2 Antibody, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GCNT2 Antibody
Anti-GCNT2 Antibody
Target: glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Product Type: Polyclonal Antibody against Human GCNT2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody targets human GCNT2, also known as glucosaminyl (N-acetyl) transferase 2, I-branching enzyme. It is affinity purified using the PrEST antigen as affinity ligand to ensure high specificity.
Alternative Gene Names
bA360O19.2, bA421M1.1, CCAT, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) |
| Target Gene | GCNT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000023778 (76%), Mouse ENSMUSG00000021360 (75%) |
Antigen Sequence:
EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



