
Atlas Antibodies Anti-GCNT2 Antibody
인간 GCNT2 단백질을 표적으로 하는 토끼 폴리클로날 항체. I 혈액형 관련 효소 검출에 적합하며, IHC 및 ICC에 사용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GCNT2 Antibody
Target: glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Product Type: Polyclonal Antibody against Human GCNT2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody targets human GCNT2, also known as glucosaminyl (N-acetyl) transferase 2, I-branching enzyme. It is affinity purified using the PrEST antigen as affinity ligand to ensure high specificity.
Alternative Gene Names
bA360O19.2, bA421M1.1, CCAT, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) |
| Target Gene | GCNT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000023778 (76%), Mouse ENSMUSG00000021360 (75%) |
Antigen Sequence:
EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GCNT4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GCNT3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GCNT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GCNT7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GCNT1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|