CacheBy
Atlas Antibodies Anti-GC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GC Antibody

상품 한눈에 보기

Human GC 단백질(Vitamin D Binding Protein)을 인식하는 Rabbit Polyclonal 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간에 대한 반응성이 검증됨.

카탈로그번호
HPA019855-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019855-100 Anti-GC Antibody, group-specific component (vitamin D binding protein) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019855-25 Anti-GC Antibody, group-specific component (vitamin D binding protein) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GC Antibody

Anti-GC Antibody

Target: group-specific component (vitamin D binding protein)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, independently validated)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human GC


Alternative Gene Names

DBP, hDBP, VDBP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein group-specific component (vitamin D binding protein)
Target Gene GC
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCAD

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Mouse ENSMUSG00000035540 (69%), Rat ENSRNOG00000003119 (64%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.