
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GC Antibody
상품 한눈에 보기
Human GC 단백질(Vitamin D Binding Protein)을 인식하는 Rabbit Polyclonal 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간에 대한 반응성이 검증됨.
- 카탈로그번호
- HPA019855-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019855-100 Anti-GC Antibody, group-specific component (vitamin D binding protein) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019855-25 Anti-GC Antibody, group-specific component (vitamin D binding protein) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GC Antibody
Anti-GC Antibody
Target: group-specific component (vitamin D binding protein)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independently validated)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human GC
Alternative Gene Names
DBP, hDBP, VDBP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | group-specific component (vitamin D binding protein) |
| Target Gene | GC |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCAD |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000035540 (69%), Rat ENSRNOG00000003119 (64%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



