CacheBy
Atlas Antibodies Anti-GATB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GATB Antibody

상품 한눈에 보기

Human GATB 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. PET112, PET112L 유전자의 대체명으로도 알려진 GATB 단백질 검출에 사용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042610-100 Anti-GATB Antibody, glutamyl-tRNA(Gln) amidotransferase, subunit B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042610-25 Anti-GATB Antibody, glutamyl-tRNA(Gln) amidotransferase, subunit B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GATB Antibody

Anti-GATB Antibody

Target: glutamyl-tRNA(Gln) amidotransferase, subunit B
Type: Polyclonal Antibody against Human GATB


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human GATB protein, a subunit of glutamyl-tRNA(Gln) amidotransferase complex.


Alternative Gene Names

  • PET112
  • PET112L

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein glutamyl-tRNA(Gln) amidotransferase, subunit B
Target Gene GATB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK
Verified Species Reactivity Human
Interspecies Identity Mouse (75%), Rat (73%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.