
Atlas Antibodies Anti-GATB Antibody
상품 한눈에 보기
Human GATB 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. PET112, PET112L 유전자의 대체명으로도 알려진 GATB 단백질 검출에 사용됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GATB Antibody
Target: glutamyl-tRNA(Gln) amidotransferase, subunit B
Type: Polyclonal Antibody against Human GATB
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human GATB protein, a subunit of glutamyl-tRNA(Gln) amidotransferase complex.
Alternative Gene Names
- PET112
- PET112L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamyl-tRNA(Gln) amidotransferase, subunit B |
| Target Gene | GATB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (73%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GATS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GATSL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GATB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GATAD2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GATAD2A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.