CacheBy
Atlas Antibodies Anti-GALNT10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALNT10 Antibody

상품 한눈에 보기

인간 GALNT10 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤과 PBS 완충액에 보존제로 나트륨 아지드가 포함됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007525-100 Anti-GALNT10 Antibody, polypeptide N-acetylgalactosaminyltransferase 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007525-25 Anti-GALNT10 Antibody, polypeptide N-acetylgalactosaminyltransferase 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALNT10 Antibody

Anti-GALNT10 Antibody

Target: polypeptide N-acetylgalactosaminyltransferase 10 (GALNT10)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human GALNT10.


Alternative Gene Names

  • GalNAc-T10

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein polypeptide N-acetylgalactosaminyltransferase 10
Target Gene GALNT10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020520 (92%)
Rat ENSRNOG00000002488 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.