CacheBy
Atlas Antibodies Anti-GALNT12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALNT12 Antibody

상품 한눈에 보기

Human GALNT12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, RNA-seq 데이터와의 비교를 통한 단백질 발현 검증이 가능합니다. Human에 반응하며 GALNT12 연구용으로 이상적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048292-100 Anti-GALNT12 Antibody, polypeptide N-acetylgalactosaminyltransferase 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048292-25 Anti-GALNT12 Antibody, polypeptide N-acetylgalactosaminyltransferase 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALNT12 Antibody

Anti-GALNT12 Antibody

Target: polypeptide N-acetylgalactosaminyltransferase 12
Type: Polyclonal Antibody against Human GALNT12


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Alternative Gene Names

  • GalNAc-T12

Open Datasheet (PDF)


Product Specifications

항목 내용
Target Protein polypeptide N-acetylgalactosaminyltransferase 12
Target Gene GALNT12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000039774 (63%), Rat ENSRNOG00000008099 (59%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.