AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GALM Antibody
상품 한눈에 보기
Human GALM 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 직교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존. 인간 GALM 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064835-100 Anti-GALM Antibody, galactose mutarotase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064835-25 Anti-GALM Antibody, galactose mutarotase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GALM Antibody
Anti-GALM Antibody
Target: galactose mutarotase (aldose 1-epimerase)
Supplier: Atlas Antibodies
Recommended Applications
직교 검증(Orthogonal validation)을 통해 IHC로 단백질 발현을 RNA-seq 데이터와 비교하여 검증함.
Product Description
Polyclonal Antibody against Human GALM
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | galactose mutarotase (aldose 1-epimerase) |
| Target Gene | GALM |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | YPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRK |
Verified Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000007023 (89%)
- Mouse ENSMUSG00000035473 (89%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.