CacheBy
Atlas Antibodies Anti-GALNS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GALNS Antibody

상품 한눈에 보기

인간 GALNS 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 다양한 조직의 GALNS 발현 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042433-100 Anti-GALNS Antibody, galactosamine (N-acetyl)-6-sulfatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042433-25 Anti-GALNS Antibody, galactosamine (N-acetyl)-6-sulfatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GALNS Antibody

Anti-GALNS Antibody

Target Protein: galactosamine (N-acetyl)-6-sulfatase
Product Type: Polyclonal Antibody against Human GALNS


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody raised in rabbit against human GALNS (galactosamine (N-acetyl)-6-sulfatase).


Alternative Gene Names

GALNAC6S, GAS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein galactosamine (N-acetyl)-6-sulfatase
Target Gene GALNS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKK
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000015027 (82%)
Rat ENSRNOG00000014461 (81%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.