Atlas Antibodies Anti-GALM Antibody

상품 한눈에 보기

인간 GALM 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035473-100 Anti-GALM Antibody, galactose mutarotase (aldose 1-epimerase) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035473-25 Anti-GALM Antibody, galactose mutarotase (aldose 1-epimerase) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: galactose mutarotase (aldose 1-epimerase)
Type: Polyclonal Antibody against Human GALM

정교한 단백질 발현 검증(Orthogonal validation)을 위해 IHC와 RNA-seq 데이터 비교를 통한 사용에 적합합니다.

Polyclonal antibody raised in rabbit against human GALM.
Validated for orthogonal comparison between protein and RNA expression levels.

항목	내용
Target Protein	galactose mutarotase (aldose 1-epimerase)
Target Gene	GALM
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRK

Highest antigen sequence identity:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand