Atlas Antibodies Anti-GADD45GIP1 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA065048-100 | - | Atlas Antibodies HPA065048-100 Anti-GADD45GIP1 Antibody, growth arrest and DNA-damage-inducible, gamma interacting protein 1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA065048-25 | - | Atlas Antibodies HPA065048-25 Anti-GADD45GIP1 Antibody, growth arrest and DNA-damage-inducible, gamma interacting protein 1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-GADD45GIP1 Antibody
growth arrest and DNA-damage-inducible, gamma interacting protein 1
Recommended Applications
Product Description
Polyclonal Antibody against Human GADD45GIP1
Alternative Gene Names
CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Target Protein
growth arrest and DNA-damage-inducible, gamma interacting protein 1
Target Gene
GADD45GIP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000003011 (79%)
Mouse ENSMUSG00000033751 (74%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|