Atlas Antibodies Anti-GADD45GIP1 Antibody
상품 한눈에 보기
Human GADD45GIP1 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종간 반응성 확인됨. 안정한 PBS/glycerol 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GADD45GIP1 Antibody
Target Protein: Growth arrest and DNA-damage-inducible, gamma interacting protein 1
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal antibody against human GADD45GIP1.
Alternative Gene Names
CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Target Information
- Target Gene: GADD45GIP1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat (ENSRNOG00000003011): 79%
- Mouse (ENSMUSG00000033751): 74%
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal conditions for each application. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-GADL1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GADD45GIP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GADD45GIP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GADD45GIP1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GADD45G Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.