CacheBy
Atlas Antibodies Anti-GAA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GAA Antibody

상품 한눈에 보기

Human GAA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse 및 Rat과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026970-100 Anti-GAA Antibody, glucosidase, alpha; acid 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026970-25 Anti-GAA Antibody, glucosidase, alpha; acid 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GAA Antibody

Anti-GAA Antibody

Target: glucosidase, alpha; acid (GAA)
Type: Polyclonal Antibody against Human GAA


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody targeting human GAA, validated for IHC and WB using recombinant expression systems.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein glucosidase, alpha; acid
Target Gene GAA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000025579 (84%), Rat ENSRNOG00000047656 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.