
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GAA Antibody
상품 한눈에 보기
Human GAA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse 및 Rat과 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026970-100 Anti-GAA Antibody, glucosidase, alpha; acid 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026970-25 Anti-GAA Antibody, glucosidase, alpha; acid 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GAA Antibody
Anti-GAA Antibody
Target: glucosidase, alpha; acid (GAA)
Type: Polyclonal Antibody against Human GAA
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody targeting human GAA, validated for IHC and WB using recombinant expression systems.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glucosidase, alpha; acid |
| Target Gene | GAA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000025579 (84%), Rat ENSRNOG00000047656 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



