Atlas Antibodies Anti-FKBP5 Antibody
인체 FKBP5 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB 검증 완료로 신뢰성 높은 단백질 발현 분석에 적합합니다. FKBP51/FKBP54 등 대체 유전자명과 교차 반응 정보를 제공합니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FKBP5 Antibody
FK506 binding protein 5
Recommended Applications
IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직 간 정합성 검증
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent antibody validation): 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통해 단백질 발현 검증
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human FKBP5
Alternative Gene Names
FKBP51, FKBP54, P54, PPIase, Ptg-10
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | FK506 binding protein 5 |
| Target Gene | FKBP5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024222 (90%), Rat ENSRNOG00000022523 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 적합한 최적의 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-FKBP5 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-FKBP4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-FKBP5 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-FKBP4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-FKBP1A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|