Atlas Antibodies Anti-FKBP5 Antibody

상품 한눈에 보기

인체 FKBP5 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB 검증 완료로 신뢰성 높은 단백질 발현 분석에 적합합니다. FKBP51/FKBP54 등 대체 유전자명과 교차 반응 정보를 제공합니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031093-100 Anti-FKBP5 Antibody, FK506 binding protein 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031093-25 Anti-FKBP5 Antibody, FK506 binding protein 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-FKBP5 Antibody

Anti-FKBP5 Antibody

FK506 binding protein 5

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직 간 정합성 검증
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent antibody validation): 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통해 단백질 발현 검증
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human FKBP5

Alternative Gene Names

FKBP51, FKBP54, P54, PPIase, Ptg-10

Open Datasheet

Target Information

항목	내용
Target Protein	FK506 binding protein 5
Target Gene	FKBP5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000024222 (90%), Rat ENSRNOG00000022523 (90%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand