
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FIS1 Antibody
상품 한눈에 보기
인간 FIS1 단백질에 대한 고품질 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 정제된 PrEST 항원 기반으로 제작되었으며, 인간·마우스·랫트 반응성이 검증되었습니다. 미토콘드리아 분열 연구에 이상적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA017430-100 Anti-FIS1 Antibody, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017430-25 Anti-FIS1 Antibody, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FIS1 Antibody
Anti-FIS1 Antibody
Target: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human FIS1.
Alternative Gene Names
CGI-135, Fis1, H_NH0132A01.6, TTC11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) |
| Target Gene | FIS1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000001420 (96%), Mouse ENSMUSG00000019054 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.


