CacheBy
Atlas Antibodies Anti-FIS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FIS1 Antibody

상품 한눈에 보기

인간 FIS1 단백질에 대한 고품질 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 정제된 PrEST 항원 기반으로 제작되었으며, 인간·마우스·랫트 반응성이 검증되었습니다. 미토콘드리아 분열 연구에 이상적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017430-100 Anti-FIS1 Antibody, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017430-25 Anti-FIS1 Antibody, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FIS1 Antibody

Anti-FIS1 Antibody

Target: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human FIS1.

Alternative Gene Names

CGI-135, Fis1, H_NH0132A01.6, TTC11

Open Datasheet

Target Information

항목 내용
Target Protein fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Target Gene FIS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000001420 (96%), Mouse ENSMUSG00000019054 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.