CacheBy
Thermo Fisher Scientific FDCSP Polyclonal Antibody
원본

Thermo Fisher Scientific FDCSP Polyclonal Antibody

상품 한눈에 보기

Human FDCSP 단백질에 특이적인 Rabbit Polyclonal 항체로, IHC(P) 실험에 적합. 합성 펩타이드(18-51aa)를 면역원으로 사용. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 02:57
Thermo Fisher Scientific PA579247 FDCSP Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific FDCSP Polyclonal Antibody

Applications

Immunohistochemistry (Paraffin) [IHC (P)]

  • Tested Dilution: 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to human FDCSP (18–51 aa: FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746363

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes a small secreted protein expressed in follicular dendritic cells. It binds specifically to activated B cells and functions as a regulator of antibody responses. It may also contribute to tumor metastasis by promoting cancer cell migration and invasion.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.