
Thermo Fisher Scientific FDCSP Polyclonal Antibody
Human FDCSP 단백질에 특이적인 Rabbit Polyclonal 항체로, IHC(P) 실험에 적합. 합성 펩타이드(18-51aa)를 면역원으로 사용. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Immunohistochemistry (Paraffin) [IHC (P)]
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human FDCSP (18–51 aa: FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746363 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a small secreted protein expressed in follicular dendritic cells. It binds specifically to activated B cells and functions as a regulator of antibody responses. It may also contribute to tumor metastasis by promoting cancer cell migration and invasion.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific FCGRT Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific FCGRT Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific FDCSP Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific FER Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific FCAR Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|