Thermo Fisher Scientific YTHDC2 Polyclonal Antibody
YTHDC2 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human 시료에 반응합니다. Immunohistochemistry (Paraffin)에서 1:1,000~1:2,500 희석으로 검증되었습니다. m6A 변형 RNA를 특이적으로 결합하며, 연구용으로 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1:1,000–1:2,500
- Publications: [References not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human YTHDC2 (Product # RP-96802) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2649741 |
Product Specific Information
Immunogen sequence:
APSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRKSSADTEFSDECTTAERVLMKSPSPALHP
- Highest antigen sequence identity to the following orthologs:
- Mouse: 94%
- Rat: 97%
Target Information
Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing, and stability.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Arfaptin 1 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific ARL13A Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific YTHDC2 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific CGGBP1 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific FAM44A Polyclonal Antibody
773,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|