CacheBy
Thermo Fisher Scientific YTHDC2 Polyclonal Antibody
원본

Thermo Fisher Scientific YTHDC2 Polyclonal Antibody

상품 한눈에 보기

YTHDC2 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human 시료에 반응합니다. Immunohistochemistry (Paraffin)에서 1:1,000~1:2,500 희석으로 검증되었습니다. m6A 변형 RNA를 특이적으로 결합하며, 연구용으로 적합합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 04:26
Thermo Fisher Scientific PA557920 YTHDC2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
773,300원VAT 포함 850,630원

Thermo Fisher Scientific · Thermo Fisher Scientific YTHDC2 Polyclonal Antibody

Applications

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 1:1,000–1:2,500
  • Publications: [References not provided]

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant protein corresponding to Human YTHDC2 (Product # RP-96802)
Conjugate Unconjugated
Form Liquid
Concentration 0.5 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2649741

Product Specific Information

Immunogen sequence:
APSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRKSSADTEFSDECTTAERVLMKSPSPALHP

  • Highest antigen sequence identity to the following orthologs:
    • Mouse: 94%
    • Rat: 97%

Target Information

Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing, and stability.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.