
원본
Thermo Fisher Scientific YTHDC2 Polyclonal Antibody
상품 한눈에 보기
YTHDC2 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human 시료에 반응합니다. Immunohistochemistry (Paraffin)에서 1:1,000~1:2,500 희석으로 검증되었습니다. m6A 변형 RNA를 특이적으로 결합하며, 연구용으로 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 04:26
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA557920 YTHDC2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
773,300원VAT 포함 850,630원
Thermo Fisher Scientific · Thermo Fisher Scientific YTHDC2 Polyclonal Antibody
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1:1,000–1:2,500
- Publications: [References not provided]
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human YTHDC2 (Product # RP-96802) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2649741 |
Product Specific Information
Immunogen sequence:
APSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRKSSADTEFSDECTTAERVLMKSPSPALHP
- Highest antigen sequence identity to the following orthologs:
- Mouse: 94%
- Rat: 97%
Target Information
Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing, and stability.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
