
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMEM72 Antibody
상품 한눈에 보기
Human TMEM72 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 직교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. 인간 시료 분석에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062907-100 Anti-TMEM72 Antibody, transmembrane protein 72 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062907-25 Anti-TMEM72 Antibody, transmembrane protein 72 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMEM72 Antibody
Anti-TMEM72 Antibody
Target: Transmembrane protein 72 (TMEM72)
Type: Polyclonal antibody against Human TMEM72
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human TMEM72 protein.
Validated for immunohistochemistry (IHC) and orthogonal analysis.
Alternative Gene Names
bA285G1.3, C10orf127, KSP37
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
KRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSA
Species Reactivity
- Verified Reactivity: Human
- Interspecies Sequence Identity:
Species Gene ID Identity Mouse ENSMUSG00000048108 82% Rat ENSRNOG00000023340 81%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



