
Atlas Antibodies Anti-TMEM72 Antibody
상품 한눈에 보기
Human TMEM72 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 직교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. 인간 시료 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM72 Antibody
Target: Transmembrane protein 72 (TMEM72)
Type: Polyclonal antibody against Human TMEM72
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human TMEM72 protein.
Validated for immunohistochemistry (IHC) and orthogonal analysis.
Alternative Gene Names
bA285G1.3, C10orf127, KSP37
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
KRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSA
Species Reactivity
- Verified Reactivity: Human
- Interspecies Sequence Identity:
Species Gene ID Identity Mouse ENSMUSG00000048108 82% Rat ENSRNOG00000023340 81%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM86A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM79 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM72 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM74B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM82 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.