
Atlas Antibodies Anti-TMEM252 Antibody
인간 TMEM252 단백질을 인식하는 토끼 폴리클로날 항체. IHC에서 RNA-seq 데이터와 비교한 직교 검증 완료. PrEST 항원을 이용해 친화 정제된 고품질 항체로, 인간에 특이적 반응성을 보임. 다양한 조직 발현 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM252 Antibody
Target: transmembrane protein 252 (TMEM252)
Type: Polyclonal Antibody against Human TMEM252
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human TMEM252.
Alternative Gene Names
C9orf71, MGC34760
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000048572 | 69% |
| Rat | ENSRNOG00000025476 | 65% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM253 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM253 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM252 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM254 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM251 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|