
Atlas Antibodies Anti-TMEM237 Antibody
상품 한눈에 보기
Human TMEM237 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. ALS2CR4, JBTS14 대체 유전자명으로도 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM237 Antibody
Target: Transmembrane protein 237 (TMEM237)
Type: Polyclonal Antibody
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Independent antibody validation: 단백질의 다른 에피토프를 인식하는 항체와 비교하여 IHC에서 단백질 발현 검증
- WB (Western Blot)
Product Description
Polyclonal antibody against human TMEM237, also known as ALS2CR4 or JBTS14.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Transmembrane protein 237 |
| Target Gene | TMEM237 |
| Alternative Gene Names | ALS2CR4, JBTS14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000038079 (88%), Rat ENSRNOG00000024085 (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM241 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM240 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM237 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM237 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM236 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.