AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMEM184B Antibody
상품 한눈에 보기
Human TMEM184B 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 제조되었으며, 재조합 발현 검증을 완료했습니다. 다양한 종에서 높은 상동성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024076-100 Anti-TMEM184B Antibody, transmembrane protein 184B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024076-25 Anti-TMEM184B Antibody, transmembrane protein 184B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMEM184B Antibody
Anti-TMEM184B Antibody
Target: transmembrane protein 184B
Type: Polyclonal Antibody against Human TMEM184B
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human TMEM184B.
Alternative Gene Names
C22orf5, DKFZP586A1024, FM08, HS5O6A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane protein 184B |
| Target Gene | TMEM184B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000009035 (97%)
- Rat ENSRNOG00000022802 (97%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.