
Atlas Antibodies Anti-TMEM177 Antibody
상품 한눈에 보기
Human TMEM177 단백질을 인식하는 Rabbit Polyclonal 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 사람에 대한 반응성이 검증되었으며, 글리세롤 및 PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMEM177 Antibody
Target: Transmembrane protein 177 (TMEM177)
Type: Polyclonal Antibody against Human TMEM177
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human transmembrane protein 177 (TMEM177).
Alternative Gene Names
- MGC10993
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Transmembrane protein 177 |
| Target Gene | TMEM177 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VVQWLYQYWPQGQPAPLPPQLQSLFQEVLQDIGVPSGHCYKPFTTFTFQPVSAGFPRLPAG |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000025484 | 90% |
| Mouse | ENSMUSG00000036975 | 90% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMEM185A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM179B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM177 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM177 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMEM173 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.