CacheBy
Atlas Antibodies Anti-TMEM164 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM164 Antibody

상품 한눈에 보기

Human TMEM164을 표적으로 하는 폴리클로날 항체로 IHC, WB, ICC에 적합함. Rabbit에서 생성된 IgG 형 항체이며 PrEST 항원으로 친화 정제됨. 인체, 생쥐, 랫트에 모두 100% 반응성을 보임. 40% glycerol/PBS buffer에 sodium azide 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038784-100 Anti-TMEM164 Antibody, transmembrane protein 164 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038784-25 Anti-TMEM164 Antibody, transmembrane protein 164 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM164 Antibody

Anti-TMEM164 Antibody

Target Information

  • Target Protein: Transmembrane protein 164
  • Target Gene: TMEM164
  • Alternative Gene Names: FLJ22679, RP13-360B22.2

Product Description

Polyclonal antibody against human TMEM164.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000047045 100%
Rat ENSRNOG00000012787 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.