
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMEM164 Antibody
상품 한눈에 보기
Human TMEM164을 표적으로 하는 폴리클로날 항체로 IHC, WB, ICC에 적합함. Rabbit에서 생성된 IgG 형 항체이며 PrEST 항원으로 친화 정제됨. 인체, 생쥐, 랫트에 모두 100% 반응성을 보임. 40% glycerol/PBS buffer에 sodium azide 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA038784-100 Anti-TMEM164 Antibody, transmembrane protein 164 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038784-25 Anti-TMEM164 Antibody, transmembrane protein 164 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMEM164 Antibody
Anti-TMEM164 Antibody
Target Information
- Target Protein: Transmembrane protein 164
- Target Gene: TMEM164
- Alternative Gene Names: FLJ22679, RP13-360B22.2
Product Description
Polyclonal antibody against human TMEM164.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000047045 | 100% |
| Rat | ENSRNOG00000012787 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



