Atlas Antibodies Anti-TMEM164 Antibody

상품 한눈에 보기

Human TMEM164을 표적으로 하는 폴리클로날 항체로 IHC, WB, ICC에 적합함. Rabbit에서 생성된 IgG 형 항체이며 PrEST 항원으로 친화 정제됨. 인체, 생쥐, 랫트에 모두 100% 반응성을 보임. 40% glycerol/PBS buffer에 sodium azide 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038784-100 Anti-TMEM164 Antibody, transmembrane protein 164 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038784-25 Anti-TMEM164 Antibody, transmembrane protein 164 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TMEM164 Antibody

Anti-TMEM164 Antibody

Target Information

Target Protein: Transmembrane protein 164
Target Gene: TMEM164
Alternative Gene Names: FLJ22679, RP13-360B22.2

Product Description

Polyclonal antibody against human TMEM164.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
```
MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
```

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000047045	100%
Rat	ENSRNOG00000012787	100%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet