CacheBy
Atlas Antibodies Anti-TMC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMC5 Antibody

상품 한눈에 보기

Human TMC5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며, Rat 및 Mouse와도 유사 서열 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040810-100 Anti-TMC5 Antibody, transmembrane channel-like 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040810-25 Anti-TMC5 Antibody, transmembrane channel-like 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMC5 Antibody

Anti-TMC5 Antibody

Target: transmembrane channel-like 5 (TMC5)
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human TMC5.


Alternative Gene Names

  • FLJ13593

Open Datasheet


Target Information

항목 내용
Target Protein transmembrane channel-like 5
Target Gene TMC5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000036760 (78%), Mouse ENSMUSG00000030650 (76%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.