
Atlas Antibodies Anti-TMBIM1 Antibody
상품 한눈에 보기
Human TMBIM1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 친화 정제되었으며, Human과 Rat 시료에 반응합니다. 40% 글리세롤 기반 완충용액에 보존되어 안정적인 실험 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TMBIM1 Antibody
Target: transmembrane BAX inhibitor motif containing 1 (TMBIM1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human TMBIM1.
Alternative Gene Names
LFG3, PP1201, RECS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane BAX inhibitor motif containing 1 |
| Target Gene | TMBIM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT |
Verified Species Reactivity
- Human
- Rat
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000014797 (88%)
- Mouse ENSMUSG00000006301 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TMBIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMBIM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMA16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TMA16 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.