CacheBy
Atlas Antibodies Anti-TIMM50 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM50 Antibody

상품 한눈에 보기

인간 TIMM50 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 고순도 정제 및 높은 종 간 보존도를 보입니다. 40% 글리세롤 기반의 안정한 보존용액에 제공됩니다.

카탈로그번호
HPA056448-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056448-100 Anti-TIMM50 Antibody, translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056448-25 Anti-TIMM50 Antibody, translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM50 Antibody

Anti-TIMM50 Antibody

Target: translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TIMM50.


Alternative Gene Names

  • TIM50L

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
Target Gene TIMM50
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000003438 (99%)
Rat ENSRNOG00000037638 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.