
Atlas Antibodies Anti-TICRR Antibody
상품 한눈에 보기
Human TICRR 단백질을 인식하는 고품질 폴리클로날 항체로, TOPBP1과 상호작용하는 복제 조절 단백질 연구에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 특이적 정제됨. 인간 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TICRR Antibody
TOPBP1 interacting checkpoint and replication regulator
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TICRR
Alternative Gene Names
C15orf42, FLJ41618, MGC45866, SLD3, Treslin
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TOPBP1 interacting checkpoint and replication regulator |
| Target Gene | TICRR |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046591 (44%), Rat ENSRNOG00000015520 (43%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TICAM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIFAB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TICRR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-THUMPD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TIA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.