CacheBy
Atlas Antibodies Anti-TICRR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TICRR Antibody

상품 한눈에 보기

Human TICRR 단백질을 인식하는 고품질 폴리클로날 항체로, TOPBP1과 상호작용하는 복제 조절 단백질 연구에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 특이적 정제됨. 인간 반응성 검증 완료.

카탈로그번호
HPA049454-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049454-100 Anti-TICRR Antibody, TOPBP1-interacting checkpoint and replication regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049454-25 Anti-TICRR Antibody, TOPBP1-interacting checkpoint and replication regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TICRR Antibody

Anti-TICRR Antibody

TOPBP1 interacting checkpoint and replication regulator


ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against Human TICRR


Alternative Gene Names

C15orf42, FLJ41618, MGC45866, SLD3, Treslin

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein TOPBP1 interacting checkpoint and replication regulator
Target Gene TICRR
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000046591 (44%), Rat ENSRNOG00000015520 (43%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.