
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TICRR Antibody
상품 한눈에 보기
Human TICRR 단백질을 인식하는 고품질 폴리클로날 항체로, TOPBP1과 상호작용하는 복제 조절 단백질 연구에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 특이적 정제됨. 인간 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA049454-100 Anti-TICRR Antibody, TOPBP1-interacting checkpoint and replication regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049454-25 Anti-TICRR Antibody, TOPBP1-interacting checkpoint and replication regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TICRR Antibody
Anti-TICRR Antibody
TOPBP1 interacting checkpoint and replication regulator
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TICRR
Alternative Gene Names
C15orf42, FLJ41618, MGC45866, SLD3, Treslin
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TOPBP1 interacting checkpoint and replication regulator |
| Target Gene | TICRR |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046591 (44%), Rat ENSRNOG00000015520 (43%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



