Anti-STAB1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-MS-1 antigen antibody produced in rabbit, Anti-Stabilin-1 precursor antibody produced in rabbit, Anti-Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1 antibody produced in rabbit, Anti-FEEL-1 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
LEYKELKGDGPFTIFVPHADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIYLNDFARVVSSDHEAVNGILH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... STAB1(23166)
Stabilin-1(STAB1) or common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) is a large, multidomain, type I transmembrane protein. It is expressed in cardiac and skeletal muscle; by macrophages in skin, gut, placenta, and pancreas; and in liver, spleen, bone marrow, and lymph nodes by sinusoidal endothelial cells. Also known as FEEL-1, it contains a proteoglycan-link protein-like sequence, 7 fasciclin domains, 2 RGD (Arg-Gly-Asp ) motifs, and 22 epidermal growth factor-like repeats.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|