Merck Anti-TXNDC16 antibody produced in rabbit
다른 상품 둘러보기
Anti-TXNDC16 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-KIAA1344, Anti-Thioredoxin domain-containing protein KIAA1344 precursor antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
PVGRGILRAYFDPLPPLPLLVLVNLHSGGQVFAFPSDQAIIEENLVLWLKKLEAGLENHITILPAQEWKPPLPAYDFLSMIDAATSQRGTRKVPKCMKETDVQENDKEQHEDKSAVRKEPIETLRIKHWN
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TXNDC16(57544)
Thioredoxin domain containing 16 (TXNDC16) belongs to the disulfide isomerase (PDI) family. It is an endoplasmic reticulum (ER)-luminal glycoprotein. It is also localized in the cytosol. It consists of five potential thioredoxin (Trx)-like domains which may form intramolecular disulfides. Mature protein consists of ten cysteine residues and four predicted N-glycosylation sites in human.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|