상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA004170-100UL | - | Merck HPA004170-100UL Anti-CAPN10 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
다른 상품 둘러보기
Anti-CAPN10 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-CANP 10 antibody produced in rabbit, Anti-Calpain-10 antibody produced in rabbit, Anti-Calcium-activated neutral proteinase 10 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CAPN10(11132)
Calpain 10 (CAPN10), member of the calpain-like cysteine protease family, is an intracellular calcium-dependent non-lysosomal cysteine protease which acts as type 2 diabetes susceptibility gene. It is ubiquitously present in various tissues such as lens, retina, brain, heart, and skeletal muscle. Its large catalytic subunit is composed of domain I (autolytic activation), domain II (cysteine catalytic site), domain III (“electrostatic switch”), and domain IV (calmodulin-like calcium binding sites).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|