상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA010725-100UL | - | Merck HPA010725-100UL Anti-C1orf43 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 |
다른 상품 둘러보기
Anti-C1orf43 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Hepatitis C virus NS5A-transactivated protein 4 antibody produced in rabbit, Anti-Protein NICE-3 antibody produced in rabbit, Anti-Uncharacterized protein C1orf43 antibody produced in rabbit, Anti-S863-3 antibody produced in rabbit, Anti-HCV NS5A-transactivated protein 4 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... C1orf43(25912)
C1orf43 (chromosome 1 open reading frame 43) belongs to epidermal differentiation complex (EDC) family of genes. It is mapped to human chromosome 1q21, and has three cDNA variants owing to alternative splicing. It might have the structural characteristics of N-4 cytosine-specific DNA methylases, and is expressed in multiple tissues. It is also found in CD34+ hematopoietic stem cells (HSPCs). C1orf43 gene shares no homology with any of the existing EDC families.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|