Merck Anti-B4GALT3 antibody produced in rabbit

Anti-B4GALT3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Anti-β-1,4-Galactosyltransferase 3 antibody produced in rabbit, Anti-UDP-Gal:β-GlcNAc β-1,4-galactosyltransferase 3 antibody produced in rabbit, Anti-UDP-galactose:β-N-acetylglucosamine β-1,4-galactosyltransferase 3 antibody produced in rabbit, Anti-β-1,4-GalTase 3 antibody produced in rabbit, Anti-b4Gal-T3 antibody produced in rabbit, Anti-β4Gal-T3 antibody produced in rabbit

생물학적 소스

rabbit

Quality Level

100

결합

unconjugated

항체 형태

affinity isolated antibody

antibody product type

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human

포장

antibody small pack of 25 μL

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS

UniProt 수납 번호

O60512

배송 상태

wet ice

저장 온도

−20°C

Gene Information

human ... B4GALT3(8703)

B4GALT3 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 3) belongs to a family of seven members, called β-1,4-galactosyltransferase (β-1,4-GalT). It is expressed in a wide range of human tissues. Its expression in fetal brain is much higher than that in adult brain. This gene is located on human chromosome 1q23. The coding region of this gene consists of one initiation codon, preceding a sequence coding for a putative hydrophobic transmembrane region. The predicted encoded protein is a type II transmembrane protein, containing a cytoplasmic N-terminal of four residues. It has a stem region, an eighteen residue transmembrane region, and a catalytic domain made of 371 amino acids, containing four potential N-linked glycosylation sites.