상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA008853-100UL | Merck HPA008853-100UL Anti-ATRN antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 |
Anti-ATRN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-DPPT-L antibody produced in rabbit, Anti-Attractin precursor antibody produced in rabbit, Anti-Mahogany homolog antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ATRN(8455)
ATRN (attractin) is a human homolog of the murine mahogany product, which exists in both membrane and secreted forms. It is expressed and secreted by activated T-cells. This gene is localized to human chromosome 20p13, and consists of 25 exons. It is a serum glycoprotein with a molecular weight of 175kDa. The membrane protein is hematopoietic tissue-specific and has a molecular weight of 134kDa. It contains a predicted serine protease catalytic domain, four EGF (epidermal growth factor)-like motifs, a CUB (complement C1r/C1s, Uegf, Bmp1) domain and a C-type lectin domain. It also contains a ligand-binding region homologous to the ligand-binding region of γ-cytokine chain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|