Merck Anti-USP14 antibody produced in rabbit
다른 상품 둘러보기
Anti-USP14 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Ubiquitin carboxyl-terminal hydrolase 14 antibody produced in rabbit, Anti-Ubiquitin thioesterase 14 antibody produced in rabbit, Anti-Deubiquitinating enzyme 14 antibody produced in rabbit, Anti-Ubiquitin-specific-processing protease 14 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
rat, human, mouse
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... USP14(9097)
USP14 is made up of 494 amino acids containing a 45kDa catalytic domain at its N-terminus. It contains a ubiquitin-like (Ubl) domain at the N-terminus that associates with 19S regulatory particle (RP) 26S proteasome. This binding activates the deubiquitinating activity of the protein.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|