| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA003229-100UL | Merck HPA003229-100UL Anti-FAM117B antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 | |
다른 상품 둘러보기
Anti-FAM117B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Amyotrophic lateral sclerosis 2 chromosome region, candidate 13 antibody produced in rabbit, Anti-ALS2CR13
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL
면역원 서열
ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FAM117B(150864)
FAM117B (family with sequence similarity 117, member B) gene is also called as ALS2CR13 (amyotrophic lateral sclerosis 2 chromosome region, candidate 13). The gene is a transcriptional unit on ALS2 gene that spans a length of 3 Mb and is mapped to human chromosome 2q33. ALS2 is expressed mainly in the neurons and spinal cord and the encoded protein contains multiple domains.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|