Merck Anti-FAM117B antibody produced in rabbit
Rabbit에서 생산된 Anti-FAM117B 항체로, 인간 FAM117B(ALS2CR13) 단백질을 검출. Prestige Antibodies® 라인 제품이며, 면역조직화학 및 Western blot에 적합. 비결합형 다클론 항체로 −20°C에서 보관.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FAM117B antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Anti-Amyotrophic lateral sclerosis 2 chromosome region, candidate 13 antibody produced in rabbit (Anti-ALS2CR13).
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
반응 종
human
포장 단위
25 μL (antibody small pack)
적용 기술
- Immunohistochemistry: 1:50–1:200
- Western blot: 0.04–0.4 μg/mL
면역원 서열
ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Gene: human FAM117B (150864)
FAM117B (family with sequence similarity 117, member B) gene is also called ALS2CR13 (amyotrophic lateral sclerosis 2 chromosome region, candidate 13).
The gene is a transcriptional unit on the ALS2 gene that spans a length of 3 Mb and is mapped to human chromosome 2q33. ALS2 is expressed mainly in neurons and spinal cord, and the encoded protein contains multiple domains.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Antibody Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | 25 μL |
| Techniques | IHC (1:50–1:200), WB (0.04–0.4 μg/mL) |
| Immunogen Sequence | ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAE |
| UniProt Accession | Q6P1L5 |
| Shipping | Wet ice |
| Storage Temperature | −20°C |
| Gene Information | FAM117B (ALS2CR13), Human chromosome 2q33 |
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-ARMCX4 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-ALG13 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-FAM117B antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-ARMCX3 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-ANGEL1 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|