Merck Anti-ADAM17 antibody produced in rabbit
다른 상품 둘러보기
Anti-ADAM17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-ADAM 17 precursor antibody produced in rabbit, Anti-A disintegrin and metalloproteinase domain 17 antibody produced in rabbit, Anti-CD156b antigen antibody produced in rabbit, Anti-Snake venom-like protease antibody produced in rabbit, Anti-TNF-α convertase antibody produced in rabbit, Anti-TNF-α-converting enzyme antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ADAM17(6868)
A disintegrin and metallopeptidase domain 17 (ADAM17) belongs to ADAM family of genes, which has a characteristic cysteine rich region called disintegrin and a metalloproteinase domain. This gene is located on chromosome 2, spans 55kb and has 9 exons. In adult humans, ADAM17 is expressed on multiple tissues such as, heart, muscle, kidney, placenta, pancreas, thymus, small intestine, ovaries, testes and prostate. In fetus, it is expressed in brain, lung, liver and kidney.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|