상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA007641-100UL | Merck HPA007641-100UL Anti-FER antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 |
Anti-FER antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-c-FER antibody produced in rabbit, Anti-Proto-oncogene tyrosine-protein kinase FER antibody produced in rabbit, Anti-Tyrosine kinase 3 antibody produced in rabbit, Anti-p94-FER antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FER(2241)
FER (fer (fps/fes related) tyrosine kinase) gene encodes a non-transmembrane receptor tyrosine kinase belonging to the FPS/FES family. The protein has a molar mass of 94kDa and contains a short, basic C-terminal tail and a large N-terminal hydrophilic domain that is similar to the 92kDa protein encoded by the mammalian c-fps/fes proto-oncogene. It contains a single SH2 domain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|