Anti-NECTIN3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CD113 antigen, Anti-nectin-3, Anti-PVRR3, Anti-DKFZP566B0846, Anti-CDw113, Anti-Poliovirus receptor-related protein 3 precursor, Anti-CD113, Anti-PPR3, Anti-PVRL3, Anti-Nectin-3
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PVRL3(25945)
PVRL3 (poliovirus receptor-related 3) belongs to nectin family, which is a family of immunoglobulin-like molecules, and are involved in cell adhesion. This family contains four members namely, PVRL1, PVRL2, PVRL3 and PVRL4. These are ubiquitously expressed and have multiple isoforms due to alternative splicing. PVRL3 is also called nectin-3 and has three isoforms called nectin-3α, -3β and -3δ. These variants differ in their transmembrane and cytosolic domains, but have identical extracellular regions. This is the only nectin to be expressed by T-cells.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|