Merck Anti-NPHP3 antibody produced in rabbit

Anti-NPHP3 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

동의어: Anti-KIAA2000, Anti-NPH3, Anti-SLSN3, Anti-MKS7, Anti-FLJ30691, Anti-FLJ36696, Anti-CFAP31

생물학적 소스

rabbit

품질 등급

100 (M-Clarity Program)

결합 형태

unconjugated

항체 형태

affinity isolated antibody

항체 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

제형

buffered aqueous glycerol solution

반응 종

human

포장 단위

antibody small pack of 25 μL

적용 기술

• Immunohistochemistry (IHC): 1:50–1:200

면역원 서열

PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS

UniProt 수납 번호

Q709F0

배송 상태

wet ice

저장 온도

−20°C

Gene Information

human NPHP3(27031)
NPHP3 (adolescent nephronophthisis 3) gene is localized to 3q21-22, and belongs to a group of proteins linked with nephronophthisis (NPHP).
NPHP is a group of cystic kidney disorders, inherited in an autosomal recessive manner.
NPHP3 protein is composed of 1330 amino acids, and in mice, it is expressed in retina, respiratory epithelium, neural tissues, biliary tract, kidney tubules, and liver.

제품 스펙 요약