Anti-PRRG4 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-Transmembrane γ-carboxyglutamic acid protein 4 precursor antibody produced in rabbit, Anti-Proline-rich γ-carboxyglutamic acid protein 4 antibody produced in rabbit, Anti-Proline-rich Gla protein 4 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
NRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PRRG4(79056)
PRRG4 (proline rich γ-carboxyglutamic acid 4) is a plasma membrane protein, which is composed of putative WW and SH3 binding motifs in its cytoplasmic domain. It contains a transmembrane domain and a Gla domain, a pro peptide and a signal peptide in its extracellular region. It is a ubiquitously expressed protein, with the highest expression in kidney, breast, lung, thyroid and the lowest expression in jejunum, proximal colon, duodenum and uterus. This gene localizes to human chromosome 11.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|